PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID MELO3C009844P1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Cucurbitales; Cucurbitaceae; Benincaseae; Cucumis
Family MYB
Protein Properties Length: 185aa    MW: 21197.3 Da    PI: 10.5306
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
MELO3C009844P1genomeMELONOMICSView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding58.21.9e-181461148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     +g+WT+eEd +l+ +++q+G g+W++ +++ g+ R++k+c++rw +yl
   MELO3C009844P1 14 KGPWTPEEDHKLLAYIHQHGHGSWRALPSKAGLERCGKSCRLRWTNYL 61
                     79********************************************97 PP

2Myb_DNA-binding537.8e-1767112148
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                      rg+++ +E++ + +++++lG++ W++Ia +++ +Rt++++k++w+++l
   MELO3C009844P1  67 RGKFSLQEEQAIEQLHALLGNR-WSAIATHLP-KRTDNEIKNYWNTHL 112
                      89********************.*********.************996 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.605.6E-25664IPR009057Homeodomain-like
PROSITE profilePS5129416.724961IPR017930Myb domain
SuperFamilySSF466896.36E-3011108IPR009057Homeodomain-like
SMARTSM007172.1E-131363IPR001005SANT/Myb domain
PfamPF002496.3E-171461IPR001005SANT/Myb domain
CDDcd001676.53E-101661No hitNo description
PROSITE profilePS5129425.97362116IPR017930Myb domain
Gene3DG3DSA:1.10.10.605.2E-2665117IPR009057Homeodomain-like
SMARTSM007171.3E-1666114IPR001005SANT/Myb domain
PfamPF002496.4E-1667112IPR001005SANT/Myb domain
CDDcd001673.84E-1169112No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 185 aa     Download sequence    Send to blast
MGRSPYCDSS GLKKGPWTPE EDHKLLAYIH QHGHGSWRAL PSKAGLERCG KSCRLRWTNY  60
LRPDIKRGKF SLQEEQAIEQ LHALLGNRWS AIATHLPKRT DNEIKNYWNT HLKKKLIKMG  120
IDPITHKPMK NNNEEMKVKS NMNNSTLSHM AQWETARLEA EERLARQHKI QPIPSSSSGS  180
VKNK*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A1e-26121165108B-MYB
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankLN6818411e-163LN681841.1 Cucumis melo genomic scaffold, anchoredscaffold00011.
GenBankLN7132581e-163LN713258.1 Cucumis melo genomic chromosome, chr_4.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_008443378.11e-133PREDICTED: transcription factor MYB76-like isoform X2
SwissprotQ9SPG55e-70MYB76_ARATH; Transcription factor MYB76
TrEMBLA0A0A0LC221e-129A0A0A0LC22_CUCSA; Uncharacterized protein
STRINGPGSC0003DMT4000033822e-96(Solanum tuberosum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF83534127
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G15310.13e-89myb domain protein 16